Prpf31

From DictyWiki

Jump to: navigation, search

Prpf31 CDS from ESTs

The 5' sequence is derived from ESTs DDB0145204, DDB0142175, DDB0083571, DDB0144331,DDB0083275, and DDB0019336.


ATGTCAACATTAGCAGATAGATTTTTAGATGATTTTAATGATGGTGAAGATGCATTAGTA
GATTATGGATTAGGAAAAAGTAATGAAAATAATAGTTTATCAAATGATTTCATTAATGAT
TTTGGTGGTGAGGAAGATAATAACAATAATAATAATGAAAATTCCACTACTACAACTACT
ACAACTACTACTACAAATATAAATATAAAGGATGATGATAATGATACATTAATGGGAGAT
CAAGATGATTTAATGTTATCAGATGAAATGATTGAAAAGAAACAAATTGAATTAATTAAT
AAACATAAAGATGCACCAATTGAATCAATTGCAAAATTAAATAATTCAAATAAATTAACA
TCATTATTAACTCGTGTAAAAAATCAAATGATAAAGAGTTTACCTGAAAAAGGTGTTAAA
ACAGGTCAAGATTCTGAAGAACATAAATTAATCGTTGAATGTAATCAAATGGCTCAAGAG
ATTCAACATGAAATTTATTTAATTCATAAATTTGTTCGTGAAAGATATTCAAAAAAATTC
CCTGAATTAGAAAGTTCCGTTCAAAATCCATTAGATTATATAAATTGTGTTAAAAGAATT
AAAAATGAAAATGATTTAATTAATGTTCAATTAAATGATTTATTACCAAAATCAACAATT
ATGGTATTATTAGTAACATTATCATCAACAGCAGGTAAAAATTTAACACAAGAAGAATTA
ATGAGAGTAATTGATGCATGTGATATGGGTTTAGAATTAGATTTACATAAAAAAAATATA
TTACATTATTTAGAGAGTAGAATGACTTATATAGCACCAAATTTATCAGTATTGATGGGA
AGTAGTATAGCATCTAAATTAATTGGTATAGCAGGTTCAATTCAACAATTAGCAAATATT
CCAGCTGGTCATTTACAAACATTAGGTGCTGATAAGAAAGCATTGGCAGGTTTTAGTGGT
ATGTCAAATAGAAAGTTTCAAATGGGTTTAATTTCACAATGTGATATTGTAAAGAAAGCA
CCACCATTCTTACAAGTTAAAGCATTACGTACTCTAACTGGTAGAGTATCGATTGCTGCA
AGAGTTGATGCTCAACAAGATTCATCATTCTATGGTGAAACAGGTAGACAATATCGTGAT
GAAATTTTAGCTAAAATTGAGAAATGGCAAGAACCACCACCTCAAAAACAAGATAAAGCA
CTACCTGCCCCTGAAGAGGGTAAGAGAACCAAGAGAGGTGGTAAAAAGGCTAGACTATAC
AAACAGAAATATGGTGTCACCGATTTTCAAAAAGCTAAAAATCGTATGTCCTTTGGTGTT
GAAGAGAAAACTATAGGTGAAAGTGGTATTGGTTTAGGTATGATTGGTGGTGAAAGTGGT
AAAGTAAGACTGGTTGCTCAAGAAAGAGGTATCCTAAAGAAAAAGAAATTGGAACAAAAA
AATTATGGTGGTTCTATGACTTCTGCTTCAACTAGTGGTCTTGCAAGTGTTGCCATTACT
CCTGTACAAGGCTTACAACTTTCTATTACTCAAAATATACGTGAACAAGATAATAAAACT
GAAAAATATTTTTCATCTTCTAGTTTTAAAAATAAAAGAAAACTTGAACAATAA

Prpf31 protein sequence based on ESTs

MSTLADRFLDDFNDGEDALVDYGLGKSNENNSLSNDFINDFGGEEDNNNNNNENSTTTTT
TTTTTNINIKDDDNDTLMGDQDDLMLSDEMIEKKQIELINKHKDAPIESIAKLNNSNKLT
SLLTRVKNQMIKSLPEKGVKTGQDSEEHKLIVECNQMAQEIQHEIYLIHKFVRERYSKKF
PELESSVQNPLDYINCVKRIKNENDLINVQLNDLLPKSTIMVLLVTLSSTAGKNLTQEEL
MRVIDACDMGLELDLHKKNILHYLESRMTYIAPNLSVLMGSSIASKLIGIAGSIQQLANI
PAGHLQTLGADKKALAGFSGMSNRKFQMGLISQCDIVKKAPPFLQVKALRTLTGRVSIAA
RVDAQQDSSFYGETGRQYRDEILAKIEKWQEPPPQKQDKALPAPEEGKRTKRGGKKARLY
KQKYGVTDFQKAKNRMSFGVEEKTIGESGIGLGMIGGESGKVRLVAQERGILKKKKLEQK
NYGGSMTSASTSGLASVAITPVQGLQLSITQNIREQDNKTEKYFSSSSFKNKRKLEQ

pfey 2 June 2009

return to prpf31 Gene Page

Personal tools