DDB G0287543

From DictyWiki

(Difference between revisions)
Jump to: navigation, search
Revision as of 19:48, 10 June 2009 (edit)
Pfey@northwestern.edu (Talk | contribs)

← Previous diff
Revision as of 22:22, 5 May 2020 (edit)
Pfey@northwestern.edu (Talk | contribs)
(Protein sequence)
Next diff →
Line 21: Line 21:
IISQLSNVEASKTAIEKQTKNNLNTVETLLSENEKLKTEIKDLKKMEKEHKAMKSQAENT IISQLSNVEASKTAIEKQTKNNLNTVETLLSENEKLKTEIKDLKKMEKEHKAMKSQAENT
TKEYLKLQEEYNQXLGKKPKTQKKDD</pre> TKEYLKLQEEYNQXLGKKPKTQKKDD</pre>
 +
 +--pfey 22:22, 5 May 2020 (UTC)
= = = =
return to [http://dictybase.org/db/cgi-bin/gene_page.pl?primary_id=DDB_G0287543 DDB_G0287543 Gene Page] return to [http://dictybase.org/db/cgi-bin/gene_page.pl?primary_id=DDB_G0287543 DDB_G0287543 Gene Page]

Revision as of 22:22, 5 May 2020

CDS derived from EST SSI190

ATGGAATTTTTAATGACATTAGTATTTTTAGTATTATTGGTTGAAATTGTATTCTGTACA
TTTTTTATGTTACCAGTTTCAATGCACCTAAGAAAGAATGTTTACAATAAATTAGATAAA
TTATTTGGTGGTCAAAATGCAAAGATCTTTTTAAAGGTATTGGCATTGTTAGTGATCATT
GTATTTTGTGATTCAATTGTAAATTCATATAATATCAACAAGAAATTACATACACCAGAA
TTGACCGGAGCTAAATTTGACAGACAAAATGAATATACCCGTATGTTTAGATATCAAAGA
AATTCATACATTTGTGGTTTCTGTCTCTATTTATTCTTTTTAATCTATCGTTCACAAGGT
ATCATTAGTCAATTATCAAATGTAGAAGCCTCAAAAACTGCCATTGAAAAGCAAACTAAA
AATAATTTAAATACCGTCGAAACTCTCTTATCGGAAAATGAAAAATTAAAAACTGAAATT
AAAGACCTTAAAAAGATGGAAAAAGAACATAAAGCTATGAAATCTCAAGCTGAAAATACA
ACCAAAGAATATCTTAAACTCCAAGAAGAATATAATCAACTNTTAGGTAAAAAACCAAAA
ACTCAAAAGAAAGATGATTAA

Protein sequence

MEFLMTLVFLVLLVEIVFCTFFMLPVSMHLRKNVYNKLDKLFGGQNAKIFLKVLALLVII
VFCDSIVNSYNINKKLHTPELTGAKFDRQNEYTRMFRYQRNSYICGFCLYLFFLIYRSQG
IISQLSNVEASKTAIEKQTKNNLNTVETLLSENEKLKTEIKDLKKMEKEHKAMKSQAENT
TKEYLKLQEEYNQXLGKKPKTQKKDD

--pfey 22:22, 5 May 2020 (UTC)

return to DDB_G0287543 Gene Page

Personal tools